«Детская школа искусств» Мошенского муниципального района

История тетрадь ответы годер 5 класс: ГДЗ Рабочая тетрадь История 5 класс Годер 1 часть

ГДЗ по истории 5 класс рабочая тетрадь 1 и 2 часть Годер

Здесь представлены ответы к рабочей тетради по истории Годер 5 класс 2013 1 и 2 часть. Вы можете смотреть и читать онлайн (без скачивания) с компьютера и мобильных устройств.

Задание № 2. Впишите недостающие слова.

Древнейшие люди жили на Земле более двух миллионов лет назад.
Древнейший человек напоминал обезьяну тем, что у него были (какие — лицо? нижняя челюсть? Лоб?) У него было грубое лицо с широким приплюснутым носом, выступающие вперед челюсти со скошенным подбородком, уходящий назад лоб, сильно развитые надбровные дуги.
Главным отличием древнейших людей от животных было то, что они умели создавать орудия труда.
Древнейшими орудиями труда были палка-копалка, дубина, скребки, рубила, каменные топоры, позднее стали изготавливать наконечники для копий.
У древнейших людей было два главных способа добывания пищи : собирательство и охота.

Задание № 3. Заполните контурную карту «Древнейшие люди на Земле».

1.Надпишите название материка, на котором археологами найдены кости и орудия труда древнейших людей.

2.Закрасьте предполагаемую область прародины человека.
3.Отметьте кружочками наиболее древние стоянки человека и его предков.

Задание № 4. Ответьте на вопросы к рисунку нашего времени.

Перед вами Африка более двух миллионов лет назад: стадо каких-то неведомых существ. Одни разыскивают пищу, другие тревожно вглядываются вдаль. Кто они? Обезьяны — далекие предки человека? Или древнейшие люди? В самом рисунке содержится ответ на эти вопросы. Найдите этот ответ и объясните свою мысль.

Это древнейшие люди. На переднем плане древнейший человек изготавливает орудие труда, обрабатывая камень. Умение изготавливать орудия труда, умение создавать, а не только потреблять — главное отличие человека от животных.

Задание № 5. Составьте по рисунку нашего времени описание охоты на пещерного медведя.

Где подстерегали охотники зверя? Как он выглядел? Опишите действия охотников. С какими целями они стремились убить медведя?

Охотники подстерегали медведя на выходе из пещеры, где, скорее всего, находится логово зверя. Это очень крупный и сильный зверь. Забравшись на уступ скалы, охотники кидают большие камни в медведя, стараясь убить или, хотя бы, оглушить зверя, чтобы потом можно было уверенно спуститься и добить медведя копьями. Скорее всего люди охотятся на медведя, чтобы добыть мясо, а может быть хотят прогнать зверя из пещеры, ведь древние люди жили в пещерах.

Задание № 6. Составьте по рисункам нашего времени рассказ об охоте на мамонтов.

1. Вот начало рассказа

Действуя слаженно и дружно, охотники погнали стадо мамонтов… Предположите куда и зачем.

Древние охотники загоняли крупных животных в заранее подготовленные ловушки — естественные или вырытые самими охотниками ямы.

Для чего охотники подожгли траву, машут факелами, громко кричат? Опишите, как выглядели мамонты.

Чтобы напугать животных, ведь дикие звери боятся огня. Это заметно по мамонтам, которые бегут прежде всего от огня, а не от охотников.

2. Предположите, куда провалился мамонт. Можно ли понять по рисунку, что охота была опасна? Если да, то чем? С какими целями первобытные люди охотились на мамонтов?

Мамонт провалился в яму, которая была прикрыта ветками. Выбраться из нее животное не сможет и охотники добьют мамонта камнями и пиками. На рисунке мы видим, что один из охотников ранен, и можно предположить, что охота была очень опасным занятием. Но охота на мамонтов приносила много мяса. Из костей животного люди изготовляли орудия труда, а из шкур делали одежду.

Задание № 7. Впишите недостающие слова.

Приблизительно 40 тысяч лет назад человек стал таким же, как люди нашего времени. Ученые называют его кроманьонцем.
Охота на быстро бегающих животных и птиц стала более успешной после изобретения лука и наконечников с загнутыми зубьями.

Задание № 8. Ответьте на вопросы.

1. Вы знаете, что «люди разумные» жили родовыми общинами. Почему такая община называется родовой?

В общину входило несколько больших семей, которые приходились родственниками друг другу.

2. Какие признаки родовой общины выражает слово «община»? Почему она так называется? Какое имущество было общим у сородичей?

Люди сообща добывали пищу, строили жилища, изготовляли орудия труда и одежду, воспитывали детей. Запасы пищи, орудия труда, жилища были общими.

3. Чем можно объяснить, что при раскопках первобытных стоянок «людей разумных» археологи находят фигурки женщин?

В родовых общинах особым уважением пользовалась женщина-мать.

Задание № 9. Выполните задание и ответьте на вопросы.

Напишите названия изображенных орудий труда. Какое из этих орудий обычно использовалось для охоты на зверя, а какое для ловли крупной рыбы? Объясните, почему вы так думаете?

1. копье 2. гарпун
Копье для охоты на зверя, а гарпун для ловли рыбы. Пронзая добычу, зубья застревали в ней, не позволяя рыбе соскользнуть с гарпуна.

Задание № 10. Ответьте на вопросы к рисунку нашего времени «Первобытный похоронный обряд».

Опишите рисунок. О каких верованиях первобытных людей можно узнать по изображенному на рисунке обряду? Почему умершего уложили в позе спящего? С какой целью на него надели ожерелье из медвежьих зубов, а в могилу положили копье?

Человека хоронят в яме, в его обычной одежде, положив в могилу еду. Древние люди считали, что душа умершего продолжает вести ту жизнь, которую вел живший человек. Хоронили в позе спящего, вероятно, потому, что считали возможным возвращение души в тело и «пробуждение» мертвого. Медвежье ожерелье являлось символом мужественного охотника, которому будет нужно копье для охоты в другом мире.

Задание № 11. Найдите ошибки.

Один ученик задремал на уроке. Приснилась ему Африка более двух миллионов лет назад… Вот движется группа похожих на обезьян людей. Все спешат уйти от непогоды — небо почернело от туч. Только двое веселых мальчишек отстают от остальных, увлеченно о чем-то разговаривая. «Хватит болтать!» — кричит на них вожак. Внезапно повалил сильный снег, все сразу продрогли, даже одежда из звериных шкур не могла защитить людей от холода. Наконец они спрятались в пещере. Тут же достали из-за пазу

ГДЗ по Истории 5 класс: Рабочая тетрадь Годер ответы

Задание № 2. Впишите недостающие слова.

Древнейшие люди жили на Земле более двух миллионов лет назад.
Древнейший человек напоминал обезьяну тем, что у него были (какие — лицо? нижняя челюсть? Лоб?) У него было грубое лицо с широким приплюснутым носом, выступающие вперед челюсти со скошенным подбородком, уходящий назад лоб, сильно развитые надбровные дуги.

Главным отличием древнейших людей от животных было то, что они умели создавать орудия труда.
Древнейшими орудиями труда были палка-копалка, дубина, скребки, рубила, каменные топоры, позднее стали изготавливать наконечники для копий.
У древнейших людей было два главных способа добывания пищи : собирательство и охота.

Задание № 3. Заполните контурную карту «Древнейшие люди на Земле».

1.Надпишите название материка, на котором археологами найдены кости и орудия труда древнейших людей.
2.Закрасьте предполагаемую область прародины человека.
3.Отметьте кружочками наиболее древние стоянки человека и его предков.

Задание № 4. Ответьте на вопросы к рисунку нашего времени.

Перед вами Африка более двух миллионов лет назад: стадо каких-то неведомых существ. Одни разыскивают пищу, другие тревожно вглядываются вдаль. Кто они? Обезьяны — далекие предки человека? Или древнейшие люди? В самом рисунке содержится ответ на эти вопросы. Найдите этот ответ и объясните свою мысль.

Это древнейшие люди. На переднем плане древнейший человек изготавливает орудие труда, обрабатывая камень. Умение изготавливать орудия труда, умение создавать, а не только потреблять — главное отличие человека от животных.

Задание № 5. Составьте по рисунку нашего времени описание охоты на пещерного медведя.

Где подстерегали охотники зверя? Как он выглядел? Опишите действия охотников. С какими целями они стремились убить медведя?

Охотники подстерегали медведя на выходе из пещеры, где, скорее всего, находится логово зверя. Это очень крупный и сильный зверь. Забравшись на уступ скалы, охотники кидают большие камни в медведя, стараясь убить или, хотя бы, оглушить зверя, чтобы потом можно было уверенно спуститься и добить медведя копьями. Скорее всего люди охотятся на медведя, чтобы добыть мясо, а может быть хотят прогнать зверя из пещеры, ведь древние люди жили в пещерах.

Задание № 6. Составьте по рисункам нашего времени рассказ об охоте на мамонтов.

1. Вот начало рассказа

Действуя слаженно и дружно, охотники погнали стадо мамонтов… Предположите куда и зачем.

Древние охотники загоняли крупных животных в заранее подготовленные ловушки — естественные или вырытые самими охотниками ямы.

Для чего охотники подожгли траву, машут факелами, громко кричат? Опишите, как выглядели мамонты.

Чтобы напугать животных, ведь дикие звери боятся огня. Это заметно по мамонтам, которые бегут прежде всего от огня, а не от охотников.

2. Предположите, куда провалился мамонт. Можно ли понять по рисунку, что охота была опасна? Если да, то чем? С какими целями первобытные люди охотились на мамонтов?

Мамонт провалился в яму, которая была прикрыта ветками. Выбраться из нее животное не сможет и охотники добьют мамонта камнями и пиками. На рисунке мы видим, что один из охотников ранен, и можно предположить, что охота была очень опасным занятием. Но охота на мамонтов приносила много мяса. Из костей животного люди изготовляли орудия труда, а из шкур делали одежду.

Задание № 7. Впишите недостающие слова.

Приблизительно 40 тысяч лет назад человек стал таким же, как люди нашего времени. Ученые называют его кроманьонцем.
Охота на быстро бегающих животных и птиц стала более успешной после изобретения лука и наконечников с загнутыми зубьями.

Задание № 8. Ответьте на вопросы.

1. Вы знаете, что «люди разумные» жили родовыми общинами. Почему такая община называется родовой?

В общину входило несколько больших семей, которые приходились родственниками друг другу.

2. Какие признаки родовой общины выражает слово «община»? Почему она так называется? Какое имущество было общим у сородичей?

Люди сообща добывали пищу, строили жилища, изготовляли орудия труда и одежду, воспитывали детей. Запасы пищи, орудия труда, жилища были общими.

3. Чем можно объяснить, что при раскопках первобытных стоянок «людей разумных» археологи находят фигурки женщин?

В родовых общинах особым уважением пользовалась женщина-мать.

Задание № 9. Выполните задание и ответьте на вопросы.

Напишите названия изображенных орудий труда. Какое из этих орудий обычно использовалось для охоты на зверя, а какое для ловли крупной рыбы? Объясните, почему вы так думаете?

1. копье 2. гарпун
Копье для охоты на зверя, а гарпун для ловли рыбы. Пронзая добычу, зубья застревали в ней, не позволяя рыбе соскользнуть с гарпуна.

Задание № 10. Ответьте на вопросы к рисунку нашего времени «Первобытный похоронный обряд».

Опишите рисунок. О каких верованиях первобытных людей можно узнать по изображенному на рисунке обряду? Почему умершего уложили в позе спящего? С какой целью на него надели ожерелье из медвежьих зубов, а в могилу положили копье?

Человека хоронят в яме, в его обычной одежде, положив в могилу еду. Древние люди считали, что душа умершего продолжает вести ту жизнь, которую вел живший человек. Хоронили в позе спящего, вероятно, потому, что считали возможным возвращение души в тело и «пробуждение» мертвого. Медвежье ожерелье являлось символом мужественного охотника, которому будет нужно копье для охоты в другом мире.

Задание № 11. Найдите ошибки.

Один ученик задремал на уроке. Приснилась ему Африка более двух миллионов лет назад… Вот движется группа похожих на обезьян людей. Все спешат уйти от непогоды — небо почернело от туч. Только двое веселых мальчишек отстают от остальных, увлеченно о чем-то разговаривая. «Хватит болтать!» — кричит на них вожак. Внезапно повалил сильный снег, все сразу продрогли, даже одежда из звериных шкур не могла защитить людей от холода. Наконец они спрятались в пещере. Тут же достали из-за пазух и стали жевать коренья, орехи и даже черствый хлеб. Вдруг все застыли от ужаса: к пещере приближался страшный хищник — огромный динозавр. Что будет дальше?! Узнать не удалось: звонок с урока прервал сон на самом интересном месте.

Какие исторические ошибки содержит сон ученика?

2 млн лет назад: а) люди не умели разговаривать, б) в Африке не мог пойти снег, в) не было одежды из звериных шкур, г) не знали хлеба, д)динозавры к тому времени вымерли.

Задание № 12. Решите кроссворд «Первобытные охотники и собиратели».

Если вы правильно решите кроссворд, то в выделенных клетках по вертикали, прочтете название пещеры, где были впервые найдены рисунки первобытных людей.

Внимание! Правильные ответы указаны в скобках.
По горизонтали: 1. Материк, где, по предположению ученых, жили древнейшие люди (Африка). 2. Оружие первобытных охотников, которым можно поразить цель на большом расстоянии (лук). 3. Первая сила природы, которой овладели первобытные люди (огонь). 4. Занятие первобытных людей, позволявшее добывать мясную пищу (охота). 5. Сверхъестественное существо, в которое верили первобытные люди; будто бы обитает в каждом человеке (душа). 6. Самое крупное из животных, на которых охотились первобытные люди (мамонт). 7. Рогатый зверь, которого часто изображали первобытные художники (бизон). 8. Первобытное орудие, особенно нужное рыболовам (гарпун). 9. Занятие первобытных людей, позволявшее добывать в основном растительную пищу (собирательство).
Ответ по вертикали: Альтамира

Задание № 13. Заполните контурную карту «Древнейший район земледелия».

1. Закрасьте древнейший район земледелия.
2. Напишите названия рек — Нил, Евфрат, Тигр, Инд, Ганг.

Задание № 14. Впишите недостающие слова.

Земледелие и скотоводство возникло в Западной Азии более 11 тыс. лет назад.
Первое домашнее животное — это собака. Потом люди одомашнили и приручили других животных, например: корова, овца, коза, свинья.

Задание № 15. Впишите недостающие слова.

Новое ремесло — обработка металлов — появилось в Западной Азии около 8 тыс. лет назад.
Первый металл, из которого люди научились делать орудия труда, назывался медь.
Украшения изготавливались из таких металлов, как золото, серебро.

Задание № 16. Решите кроссворд «Первобытные земледельцы и скотоводы».

Если вы правильно решите кроссворд, то в выделенных клетках по диагонали, прочтете название возникшего из собирательства занятия, обеспечивающего людей растительной пищей.

Внимание! Правильные ответы указаны в скобках.
По горизонтали: 1. Металл, из которого первобытные люди изготавливали украшения (золото). 2. Подарок, приносимый первобытными людьми духам и богам (жертва). 3. Первый металл, из которого люди научились делать орудия труда (медь). 4. Просьба, с которой люди обращались к богам и духам (молитва). 5. Изготовление льняного полотна и шерстяной ткани из нитей (ткачество). 6. Возникшее из охоты занятие, надежно обеспечивающее людей мясной пищей (скотоводство). 7. Изготовление нитей из шерсти животных или из волокон растений (прядение). 8. Орудие для пахоты, пришедшее на смену мотыге (плуг). 9. Изображение духа или бога (обычно из дерева, глины или камня) (идол). 10. Несколько родовых общин, живших в одной местности (племя).
Ответ по диагонали: Земледелие.

Задание № 17. Найдите ошибки.

Один ученик был большим выдумщиком. Он написал сочинение о первых земледельцах и скотоводах. Вот оно:

«Наступило время жатвы. На хлебное поле вышли сородичи с серпами. Своими грубыми лицами с приплюснутыми носами и выступающими вперед тяжелыми челюстями они напоминали обезьян.
Три женщины устроили состязание — чей сноп будет больше. Победила самая юная — ее связка стеблей ячменя с колосьями была самой большой.
— Нечестно! — заметил руководитель родовой общины, черноволосый парень, следивший за работой. — У тебя серп железный, а у них серпы медные.
Тут в загоне рядом с полем тревожно заблеяли овцы и козы. Они сломали загородку и побежали в лес. Не съели бы их волки! Как вернуть беглецов? Собак в поселке не было — в те времена они еще не были приручены. Но скоро и людям стало страшно. Прямо на поселок двигалось стадо мамонтов. Еще немного и они растопчут и поле, и хижины. Кто-то из родичей догадался поджечь травму и хворост: едкий дым заставил мамонтов повернуть, и они обошли поселок стороной».

В этом сочинении не менее пяти исторических ошибок. Найдите и опишите их.

а) когда возникло земледелие, люди уже имели облик современного человека, б) родовая община уступала место соседской, в) руководителем общины мог быть только старейшина, г) первые земледельцы пользовались серпами, сделанными из кремня, медь научились обрабатывать намного позже, д) железо не было известно в то время, е) собака была приручена человеком задолго до возникновения земледелия, ж) мамонты к тому времени вымерли.

Задание № 18. Заполните «линию времени».

Первое упоминание в летописи о Москве относится к 1147 году. Отметьте на «линии времени» этот год. Подсчитайте, сколько лет исполнилось Москве в нынешнем году (в 2013 году). Вычисления делайте письменно.

866 лет. 2013-1147=866.

Задание № 19. Заполните «линию времени».

Отметьте на «линии времени» 100-й год до н.э. и 100-й год н.э. Подсчитайте, какой год был раньше. На сколько раньше?

100 год до н.э. был раньше, чем 100 год н.э. на 200 лет.

Задание № 20. Заполните «линию времени».

Отметьте на «линии времени» год основания города Рима — 753 год до н.э. Подсчитайте, в каком году жители Рима смогут отметить трехтысячелетие своего города. Вычисления делайте письменно.

В 2247 году. 3000-753=2247.

Задание № 21. Найдите ошибку.

Представьте себе, что в один музей принесли древний меч. На мече вырезана надпись: «Этим оружием Спартак поражал врагов. Надпись сделана друзьями Спартака через два дня после гибели в 71 году до Рождества Христова». Осмотревшие меч ученые знали, что вождь восставших рабов по имени Спартак действительно погиб в 71 году до н.э. Несмотря на это, они заявили, что надпись фальшивая: она сделана не друзьями Спартака, а много-много лет позже. Объясните, почему ученые пришли к такому выводу.

а) «друзья» Спартака не могли знать о «Рождестве Христовом», которое произошло на 71 год позже описываемых событий, б) система летоисчисления «от Рождества Христова» стала применяться в 6 веке нашей эры и тоже не могла быть известна во времена Спартака.

Задание № 22. Впишите недостающие слова.

Египет — так называлась страна, которая располагалась (по берегам какой реки? От какого места и до какого моря?) по берегам реки Нил от первых порогов до Средиземного моря (на каком материке? В какой его части?) в северо-восточной части Африки.
Первой столицей Египетского государства стал город Мемфис.
Царей Древнего Египта называют фараон.

Задание № 23. Ответьте на вопросы и выполните задание.

В древнеегипетской «Повести о двух братьях» старший брат говорит младшему: «Давай приготовим плуг и упряжку быков, потому что хлебное поле вышло из-под воды…»

Объясните эти слова старшего брата. Чем он предлагает заняться? В каком месяце по нашему календарю поля в Древнем Египте освобождались от воды? С каким явлением природы это было связано? Опишите его.

Он предлагал заняться пахотой. В июле Нил начинал разливаться, что связано с сезоном тропических ливней в районах истоков реки. Течением приносило перегнившие тропические растения и солевые осадки, что служило прекрасным удобрением. К ноябрю вода спадала и наступало время пахоты.

Задание № 24. Выполните задание по рисунку нашего времени.

В древнеегипетском тексте сказано: «Горе земледельцу! Он связан, связаны его жена и дети».

Опишите рисунок, посвященный сбору налогов в Египте. Предположите, кто этот египтянин в белых одеждах и с посохом в руке. Что за люди его сопровождают (справа)? Чем занят сидящий на земле человек со скрещенными ногами? Правее его изображены две пустые корзины: чем они будут наполнены? Кого и почему поставили на колени (в центре)? Кто эта женщина с детьми (слева)? Почему происходящее стало для земледельца горем?

В белой одежде изображен сборщик налогов. Его сопровождает вооруженная охрана и носильщики. На земле сидит писец, в документах которого записано сколько должно быть изъято зерна, для которого приготовили корзины, изображенные правее писца. Крестьянин, вероятно, не может сдать зерно, потому его поставили на колени. Слева мы видим его жену и детей. В Древнем Египте даже стихийные бедствия не освобождали от налога и крестьянину грозит суровое наказание.

Задание № 25. Заполните контурную карту «Древний Египет».

1. Надпишите название реки, протекающей через Египет, и обозначьте на ней 1-й порог.
2. Закрасьте зеленым цветом районы земледелия в Египте (границы районов обозначены пунктиром).
3. Надпишите названия двух морей, ближайших к Египту.
4. Закрасьте кружочек, обозначающий древнюю столицу Египта, и надпишите ее название.
5. Обозначьте значком район пирамид.

Задание № 26. Заполните «линию времени».

Отметьте на «линии времени» год образования единого государства в Египте. Подсчитайте, сколько лет назад это было. Вычисления делайте письменно.

Это было 5013 лет назад. 3000+2013= 5013

Задание № 27. Впишите недостающие слова.

Самые крупные завоевания совершил около 1500 года до н.э. Фараон по имени Тутмос.
У египетских воинов наконечники копий, топорики и клинки изготавливались из бронзы. Так называется сплав двух металлов: меди и олова.
Войсками фараонов были завоеваны в Африке богатая золотом страна Нубия, в Азии — богатый залежами медной руды Синайский полуостров и страны:
1. Палестина
2. Финикия
3. Сирия
Границы Египетского царства в Азии доходили до реки Евфрат, а в Африке — до 5 порога на реке Нил.

Задание № 28. Впишите недостающие даты.

Единое государство в Египте образовалось около 3000 года до н.э.
Пирамида фараона Хеопса была построена около 2560 года до н.э.
Завоевания фараона Тутмоса были сделаны около 1500 года до н.э.

Задание № 29. Заполните контурную карту «Военные походы фараонов».

1. Обозначьте стрелками направления завоевательных походов египетских войск.
2. Обведите границы Египетского царства около 1500 года до н.э.
3. Надпишите название азиатской реки, до которой доходили границы Египетского царства на севере (Евфрат).
4. Закрасьте кружочек, обозначающий город в Азии, который более полугода осаждали войска фараона Тутмоса, и надпишите название этого города (Мегиддо).
5. Закрасьте кружочек, обозначающий столицу Египта во времена фараона Тутмоса, и надпишите название этого города (Фивы).
6. Страны и полуостров, завоеванные фараонами за пределами Египта, обозначены на карте цифрами. Напишите их названия:
1. Нубия
2. Синайский полуостров
3. Палестина
4. Финикия
5. Сирия

Задание № 30. Заполните «линию времени».

Отметьте на «линии времени» даты, связанные с правлением фараонов Хеопса и Тутмоса. Могли ли эти владыки Египта что-нибудь знать друг о друге? Объясните, почему так считаете.

Только Тутмос мог знать о Хеопсе, так как жил после него.

Задание № 31. Впишите недостающие буквы в имена богов и священных животных, почитавшихся древними египтянами.

Амон — бог солнца
Апоп — бог тьмы
Геб — бог земли
Нут — богиня неба
Тот — бог мудрости
Бастет — покровительница женщин и их красоты
Апис — священный бык
Сет — бог пустыни
Осирис — фараон и судья в царстве мертвых
Гор — бог — покровитель правящего в Египте фараона
Исида — богиня — жена Осириса
Анубис — бог — покровитель умерших
Маат — богиня правды

Задание № 32. Вспомните мифы о богах и ответьте на вопросы.

1. Как египтяне именовали Кота и Змея, изображенных на рисунке нашего времени? Кто всегда побеждает в схватке между Котом и Змеем? Где она происходит? Как долго продолжается?

В образе кота изображен бог солнца Ра, в образе змея — бог тьмы и зла Апоп. Каждую ночь они сражаются под землей и Ра всегда побеждает Апопа.

2. Опишите рисунок нашего времени. Что изображено на нем? Чьи имена из тех, кто изображен на рисунке, вам известны? Что вы знаете о каждом из них? С какой целью принесен деревянный ящик?

Согласно мифу Сет принес в дом Осириса саркофаг и предложил гостям узнать, кому тот будет по росту. Когда в саркофаг лег Осирис, Сет захлопнул его и выбросил в Нил. Осирис и Сет были братьями. Осирис затем стал царем подземного царства, а Сет богом хаоса, разрушения, войны, стал олицетворением зла, сатаной.

Задание № 33. Ответьте на вопросы.

Вспомните сказания о богах. Кто мог бы сказать о себе такие слова? По какому поводу?

1. Я скрывала его, я прятала его из страха, чтобы его не убили. Позвала я обитателей болот, чтобы они помогли мне. Одна мудрая женщина сказала мне: «Не унывай и не бойся! Ребенок твой недоступен своему противнику: заросли непроходимы, смерть не входит через них!»

Исида. После смерти своего мужа, Осириса, Исида была вынуждена прятаться вместе со своим сыном Гором, чтобы спасти его от Сета.

2. Зависть и злоба терзают меня. Тот, кому я завидую, красив, добр, повелевает тысячами людей. Меня же все они проклинают и ненавидят. Ради захвата власти в стране я пойду на все, вплоть до убийства.

Сет. Он был братом Осириса, правившего Египтом. Сет завидовал брату и стремился захватить власть.

3. Имя мое Амамат, что значит «Пожирательница». Тем из вас, кто не делал зла и не был причиной чужих слез, не надо бояться моих острых зубов. Но горе завистникам, лгунам и ворам! Рано или поздно мы с ними встретимся.

Мифическое существо в образе гиппопотама с лапами и гривой льва и головой крокодила. Обитала в подземном царстве. На суде Осириса она пожирала души грешников.

Задание № 34. Ответьте на вопросы к рисунку нашего времени.

Ночь… Куда крадучись идут двое египтянин? «Я боюсь гнева богов!» — дрожит от страха один. «Не будь трусом — мы умилостивим богов жертвами! Поспешим, я знаю, как проникнуть внутрь!» — торопит другой.

Что они замышляют? Чем привлекают их каменные громады? Вы дадите ответ, если вспомните, что нашли археологи в неразграбленной гробнице Тутанхамона, вырубленной в скалах на западном берегу Нила.

Они пробираются к пирамидам, чтобы ограбить их. После смерти фараона хоронили в саркофаге, который был сделан из чистого золота, но помимо самого саркофага усыпальницу заполняли драгоценностями, украшениями, ценными вещами.

Задание № 35. Рассмотрите на передней обложке тетради роспись из древнеегипетской гробницы, ответьте на вопросы, вставьте недостающие слова.

1. Кто из египетских богов изображен справа? Как выглядел этот бог по представлениям египтян? В какое место он поведет однажды каждого из живущих на земле?

Бог Древнего Египта Анубис, с головой шакала и телом человека. Он был проводником умерших в загробный мир.

2. Какую клятву в этом месте готовились произнести египтяне? Как, согласно их верованиям, становилось известно, не лгут ли они?

Египтяне клялись, что не совершали грехов. Сердце умершего, то есть душу, взвешивали на весах Тот и Анубис. На другой чаше весов лежало перо богини правды Маат. Если душа была легче пера, значит египтянин говорил правду.

3. Определите по головному убору, кем был изображенный слева человек. Опишите его одежду и украшения.

Это фараон. На нем одета набедренная повязка с богато украшенным передником. На плечах украшение — ожерелье-оплечье и браслеты на руках.

4. Предположите, для чего на стене гробницы помещены небольшие рисунки. Кого или что они изображают? Почему некоторые из них обведены овальной рамкой?

Египтяне верили, что все изображенное на стенах сопровождало умершего в загробном мире, потому изображали себя, свой дом, семью и все, что окружало человека при жизни. Овальной рамкой обводили только имена фараона и его жен.

5. Вспомните, как в Египте на рельефах и в росписях было принято изображать человека. Мы как бы смотрим на него с разных точек зрения. На одни части его тела — спереди (на какие именно?): на плечи и глаза, а на другие — сбоку (на какие?): на голову и ноги.

Задание № 36. Рассмотрите на задней обложке тетради древнеегипетские статуи, выполните задания и ответьте на вопросы.

1. Почему статуи вельможи и его жены были поставлены в гробнице? Почему статуи должны были быть похожи на людей, похороненных в гробнице?

Согласно верованиям египтян, душа умершего время от времени возвращается из царства Осириса и вселяется в мумию. Если душа, прилетев в гробницу, не обнаружит мумии, она погибнет и её загробная жизнь прекратится. Поэтому в гробницу ставили каменную или деревянную статую умершего, в точности воспроизводящую его облик. Верили, что душа может вселиться в статую, если мумия не сохранится.

2. Предположите, почему вельможа и его жена изображены молодыми людьми, хотя, быть может, они умерли в старости.

По представлениям египтян, на «полях Осириса», то есть в раю, все молоды и красивы.

3. Опишите каждую из статуй. В каких позах представлены вельможа и его жена? В каком положении находятся их руки и ноги?

Статуи в сидячем положении, ноги расположены вместе, а правая рука на сердце.

4. Почему вельможа и его жена изображены с кожей разного цвета?

Это связано с техникой живописи. Мужчины всегда изображались с более темной кожей.

Задание № 37. Ответьте на вопросы.

1. Почему человек, умеющий читать и писать, казался египтянам настоящим мудрецом?

В Древнем Египте существовало огромное число иероглифов (более 500), система письма была очень сложной, потому выучить ее представлялось огромным трудом.

2. Кому было легче овладеть грамотой: мальчику в Древнем Египте или российскому школьнику в наши дни? Объясните, почему вы так думаете.

Школьнику наших дней легче. В русском алфавите 33 буквы и помимо согласных, есть гласные звуки. В египетском же письме иероглифов, обозначающих гласные, не было, помимо этого число иероглифов было огромным, и, вдобавок, для правильного чтения сочетаний иероглифов использовали специальные значки. Все это сильно усложняло письмо.

3. На чём и чем писали ученики египетских школ?

Сначала писали на черепках глиняной посуды. Когда ученик овладевал письмом, ему давали для письма папирус. Писали тонкой тростниковой палочкой, используя черную и красную краски.

4. Почему окончившие школу египтяне могли позволить себе носить белые одежды, а на руках у них не было мозолей?

Профессия писца считалась престижной и очень доходной, они были частью двора фараонов и освобождались от уплаты налогов, службы в армии и какой бы то ни было физической работы.

Задание № 38. Решите древнюю задачу и ответьте на вопросы.

В написанном на папирусе древнеегипетском задачнике для школы имеется такая задача: «Было семь домов, в каждом семь кошек, каждая кошка съела семь мышей, каждая мышь съела семь колосков, каждый съеденный колос мог бы дать семь мер зерна. Найдите сумму общего числа домов, кошек, мышей, колосьев и мер зерна

Гдз по Истории за 5 класс рабочая тетрадь, авторы Г.И. Годер часть 1, 2

  • 1 Класс
    • Математика
    • Русский язык
    • Английский язык
    • Информатика
    • Литература
    • Человек и мир
    • Окружающий мир
    • Музыка
    • Технология
  • 2 Класс
    • Математика
    • Русский язык
    • Белорусский язык

Основные термины и даты по курсу История Древнего мира. | Материал по истории (5 класс) на тему:

Основные термины и даты по курсу История Древнего мира.

5 класс.

Глава 1.

Термины.

1.Первобытные люди - люди, жившие до появление письма, первых государств.

2.Охота, рыболовство, собирательство - занятия первобытных людей.

3.Религия - вера в богов, сверхъестественные силы.

4.Родовая община- люди, связанные кровным родством.

5.Соседская община-коллектив людей, не связанных родственными узами.

Даты.

2 миллиона лет до н.э. - появление древнейших людей.

40 тысяч лет до н.э. - появление разумного (современного) человека.

Глава 2.

Термины

Племя - союз нескольких родовых общин. Племенем управлял совет старейшин.

Ремесленник - человек, который занимается изготовлением сосудов, орудий труда, тканей и т.д.

Вождь -глава племени.

Знать - самые богатые люди племени.

Царь -правитель государства.

Даты

10 тысяч лет до н.э. - возникновение земледелия и скотоводства. Земледелие возникло из собирательства, а скотоводство из охоты.

9 тысяч лет до н.э. - появилась обработка металлов. Первый метал - медь.

Глава 4.Древний Египет.

Термины.

1.Государство – это организация власти одного класса над другим.

2.Египет - страна, которая располагается  на берегу реки Нил от первого порога до Средиземного моря. Египет находится в северо-восточной Африке.

3.Фараон -царь Египта.

4.Вельможа - царский советник.

5.Налог  - плата в казну государства, значительной частью урожая или приплода скота.

6.Бронза - сплав меди и олова. Оружие у египтян было бронзовым.

7.Раб - человек, потерявший свободу.

8.Жрецы -служители богов.

9.Ра, Осирис, Исида, Сет, Гор, Тот - боги Древнего Египта.

10.Пирамида -гробница фараона. Самая высокая пирамида Хеопса.

11.Иероглифы - письменность древних египтян.

12. Папирус - материал для письма в Древнем Египте.

Даты.

5 тысяч лет до н.э. - появление письменности и первых государств.

3 тысячи лет до н.э. - объединение Египта. Столица (главный город) Египта -Мемфис.

1500 лет до н.э. -завоевательные походы Тутмоса

Глава 5.Древнее Двуречье.

Термины.

1.Двуречье - территория между двумя реками Тигр и Евфрат.

2.Ур, Урук, Лагаш, Вавилон - города Древнего Двуречья.

3.Шамаш,Син, Иштар - боги Древнего Двуречья.

4.Клинопись - письменность Древнего Двуречья.

5.Законы - правила, установленные правителем.

6.Финикия - государство на восточном побережье Средиземного моря.

7.Библ, Тир, Сидон - города Финикии.

8.Колония - поселение за пределами родной страны.

9.Алфавит -письменность в Финикии. Был изобретен 3000 лет до нашей эры.

10.Кочевники - племена, не имеющие постоянных поселений.

11. Иосиф, Моисей, Давид, Самсон, Саул - герои, чьи деяния описаны в Библии (священная книга).

12.Ассирия - держава в верхнем течении Тигра.

13.Держава - большое и сильное государство.

14. Персия - государство в Западной Азии, около Персидского залива.

Даты.

1792-1750 годы до н.э. - правление Хаммурапи

10 век до н.э. - столицей Еврейского царства стал Иерусалим.

10 век до н.э. - ассирийцы научились обрабатывать железо.

8-7 века до н.э.- ассирийцы завоевали Вавилон, Библ, Тир, Сидон и часть Палестины.

612 год до н.э.- Ниневия, столица Ассирии, была захвачена.

538 год до н.э. - Вавилон завоеван персами

525 год до н.э. - персы завоевали Египет

         

                              Глава 6. Древняя Индия и Древний Китай.

Термины.

1.Индия - страна в Южной Азии.

2.Инд и Ганг - реки Индии.

3.Джунгли - труднопроходимые леса в Индии.

4.Каста -группа людей, обладающая определенными правами и обязанностями.

5.Брахман - жрец, который относился к высшей касте в Древней Индии

6.Буддизм - мировая религия, которая возникла в 5 веке до нашей эры в Индии. Основатель Будда.

7.Китай - страна в Восточной Азии.

8.Конфуций - древнекитайский мудрец.

9.Поднебесная - так называют китайцы свою страну.

10.Бамбук - материал для письма в Древнем Китае.

11.Шелк, порох, компас, бумага - великие изобретения китайцев.

Даты.

3 век до нашей эры - Ашока объединил индийский царства.

221 год  до нашей эры - Цинь Шихуан стал первым и единственным правителем Китая.

Глава 7.Древняя Греция.

Термины

1.Греция - страна на юге Балканского полуострова.

2.Микены, Тиринф, Пилос - древнегреческие города.

3.Крит - остров в Средиземном море.

4.Тесей - древнегреческий герой, который победил Минотавра (чудовище, жившее в Лабиринте на Крите).

5.Минос - царь Крита.

6.Кносс - столица Критской империи.

7.Троя - город в Малой Азии.

8.Гомер - древнегреческий поэт, автор "Иллиады"  и "Одиссеи".

9.Ахиллес, Одиссей, Менелай - герои,  сражавшиеся во время Троянской войны на стороне греков.

10.Парис,Гектор,Приам - герои,  сражавшиеся во время Троянской войны на стороне троянцев.

11.Древнегреческие боги:

а)Зевс - бог-громовержец, царь богов и людей.

б)Посейдон - бог моря.

в)Аид-бог подземного мира

г)Афродита - богиня любви, красоты.

д)Артемида - богиня охоты.

е)Апполон - бог музыки и искусств.

ж)Афина-богиня мудрости, справедливой войны.

з)Арес - бог войны

и)Гефест - бог кузнец

к)Деметра - богиня земледелия

л)Дионис - бог виноделия

м)Гермес - бог торговли

12.Одиссей, Пенелопа, Телемак, Полифем - герои поэмы "Одиссея". 

Даты.

1500 год до нашей эры- извержение вулкана, гибель Критской империи.

1200 - 1210 годы до нашей эры -Троянская война.

Глава 8. Полисы Древней Греции.

Термины.

1.Полис- независимый город-государство в Древней Греции. 

2.Аттика - область в Средней Греции. Центр Аттики - Афины.

3.Ареопаг - совет знати в Древней Греции.

4.Архонт - правитель в Афинах.

5.Драконт - архонт, прославившийся жестокими "драконовскими" законами.

6. Солон - архонт-законодатель. Он отменил долговое рабство. Грек не мог быть рабом. Архонтом мог стать, как богатый, так и бедный грек.

7.Демос - простой народ в Древней Греции.

8.Демократия - власть простого народа.

9.Граждане - свободные афиняне.

10.Народное собрание -  собрания граждан государства для рассуждения об общественных делах, для издания законов, для избрания должностных лиц.

11.Лакония - область в Южной Греции. Центр Лаконии - Спарта.

12.Илоты - рабы в Древней Спарта. Илоты жители области Мессения.

13.Пираты - морские разбойники.

14.Скифы - племена, обитавшие на побережье Черного моря.

14.Ольвия,Херсонес,Пантикопей - колонии греков на побережье Черного моря.

15.Эллада - так греки называли свою страну.

16.Атлет -участник Олимпийских игр

17.Ипподром - место для конных состязаний.

18.Фаланга - строй сомкнутыми рядами в Древней Греции.

19.Стратег - военачальник в Древней Греции.

20.Мильтиад, Фемистокл - стратеги в период греко-персидских войск.

21.Дарий, Ксеркс - персидские цари в период греко-персидских войск.

22.Триера -военный корабль древних греков.

22. Леонид - легендарный спартанский царь, участник боя в Фермопильском ущелье.

23.Эсхил - древнегреческий поэт, участник Саламинского сражения.

Даты.

8 век до нашей эры - изобретение греческого алфавита.

594 год до нашей эры - на должность архонта избран Солон.

776 год до нашей - первые Олимпийские игры.

490 год до нашей эры - Марафонская битва. Персидскими войсками командовал Дарий.

480 год до нашей эры - бой в Фермопильском ущелье, Саламинское сражение. Персидскими войсками командовал Ксеркс.

Глава 9.

Термины.

1.Пирей-главный порт Афин.

2.Пошлина - плата, которую отдавали иноземные купцы, за право торговать в Афинах.

3.Вольноотпущенник - раб, который  получил свободу.

4.Керамик - район  гончарных мастерских в Афинах.

5.Агора - главная площадь Афин, где ежедневно собирался Совет пятисот.

Право иноземного

6.Акрополь- холм с крутыми и обрывистыми склонами в Афинах. На Акрополе находился Парфенон (храм богини Афины).

7.Фидий,Милон, Поликлет - великие древнегреческие скульпторы.

8.Педагог - раб, который занимался воспитанием детей в Древней Греции.

9.Стиль -палочка для письма.

10.Палестра, гимнасий - виды школ в Древней Греции.

11. Театр — место для зрелищ.

12. Орхестра - круглая или полукруглая площадка, на которой выступали актеры и хор.

13. Скене - постройка, примыкавшая к орхестре.

14.Софокл, Аристофан - древнегреческие драматурги ( создатели сценариев для театральных представлений). Софокл придумал трагедию, а Аристофан - комедию.

15.Перикл - вождь афинского демоса, который несколько десятилетий занимал должность первого стратега. Первый стратег решал вопросы о войне и мире, руководил армией и флотом. Стратегов выбирали сроком на один год.

16. Оратор - человек, умеющий произносить речи, убеждать слушателей.

17.Реформы Перикла: 1. введение оплаты должностным лицам;

2.создание специального фонда для раздачи малоимущим гражданам денег на посещение театра; 3.строительство общественных зданий, дававшее работу многим гражданам.)

Даты:

443-428-первым стратегом в Афинах избирался Перикл.

Глава 10.

                                                          Термины:

1.Македония -  маленькая горная страна в Северной Греции.

2.Филипп, Александр - цари Македонии.

3.Аристотель - древнегреческий ученый, учитель Александра Македонского.

4.Демосфен - древнегреческий оратор, который смог убедить часть полисов объединиться против Македонии.

5.Парменион - македонский военачальник, друг Александра.

6.Дарий Третий - персидский царь, противник Александра.

7. Средиземноморье - общее название для стран, расположенных по берегам Средиземного моря.

8.Александрия - город на острове Фарос, основанный Александром. В городе были построено одно из Чудес света - Фаросский маяк

                                                       Даты:

338 год до нашей эры- битва при Херонее. Победа Македонии, разгром сил  греческих полисов.

Поход Александра Македонского на Восток.

Дата

(до н. э.)

События

Результат

334

Битва при Гранике

Открыт путь в Малую Азию, к греческим городам под персидским господством

333

Битва при г. Иссе

Уничтожена часть персидской армии, от державы Дария III отрезаны Сирия, Финикия и Египет

332

Осада и взятие Тира

Подчинён бассейн Средиземного моря

332-331

Подчинение Египта

Обеспечен подвоз продовольствия в Грецию и другие области Македонской державы

331

Битва при Гавгамелах

Полностью сломлены военные силы Дария III.

329

Война в Бактрии и Согдиане

Подавлены последние очаги сопротивления в Персии

327

Война в Индии. Битва

с Пором при Гидаспе.

Крайние истощение сил македонского войска

323

Смерть Александра Македонского

Начало развала созданной в процессе завоевания державы – империи Александра Македонского.

Глава 11.Древнейший Рим.

Термины.

1.Рим - город на берегу реки Тибр, в Италии. Построен на семи холмах. Самые известные Палатин и Капитолий.

2.Италия - страна на Аппенинском полуострове.

3.Латины - племя, жившее по берегу Тибра.

4.Нумитор,Амулий, Рея Сильвия - легендарные герои племени латин.

5.Ромул и Рем - основатели Рима.

6.Весталка - жрица богини домашнего очага (Весты).

7.Ликторы - охрана древнеримского царя.

8.Патриции - жители Рима, потомки его древнейших жителей.

9.Плебеи - жители Рима, переселенцы из других завоеванных областей Италии.

10.Консулы - два-правителя в Римской республике, избираемые сроком на один год. Консулом мог стать патриций, а позже и плебей. Должность не оплачивалась, поэтому только богатые были способные ее занять.

11.Народный трибун - должностное лицо, избираемое из плебеев. Имели право вето (зап

Магазин учебных программ - не найдено

AllShop По классам Уровень --- Дошкольный детский сад --- 1-й класс --- 2-й класс --- 3-й класс --- 4-й класс --- 5-й класс --- 6-й класс --- 7-й класс --- 8-й класс --- 9-й класс --- 10-й класс --- 11-й класс --- 12-й класс Магазин по предметам --- Полные комплекты учебных программ ------ 1-5 классы ------ 6-8 классы - ---- 9-12 классы ------ Дошкольный детский сад --- Язык и чтение ------ 1-5 классы ------ 6-8 классы ------ 9–12 классы ------ Дошкольное учреждение - Детский сад --- Математика ------ 1–5 классы ------ 6–8 классы ------ 9–12 классы --- --- Дошкольное учреждение-детский сад --- Наука ------ 1-5 классы ------ 6-8 классы ------ 9-12 классы ------ Дошкольное учреждение-детский сад- - Социальные науки ------ 1-5 классы ------ 6-8 классы ------ 9-12 классы ------ Дошкольное учреждение - Детский сад --- Факультативы --- --- 1-5 классы ------ 6-8 классы ------ 9-12 классы ------ Дошкольное учреждение - детский сад --- Подготовка к экзаменам ------ 1 класс- 5 ------ 6-8 классы ------ 9-12 классы Магазин по учебной программе --- Все об обучении Пресса --- AOP Horizons --- AOP Lifepac --- AOP Monarch --- AOP Switched На Sch oolhouse --- Apologia --- D'Nealian Почерк --- enVision Math --- Go Math --- HMH Collections --- HMH Into Social Studies --- HMH Journeys --- HMH Science Dimensions --- HMH Social Исследования --- Holt McDougal Science --- Holt McDougal Social Studies --- Holt Science & Technology --- Увлеченные фонетикой --- Интерактивные науки --- Математика в фокусе --- McDougal Littell Science --- MCP Computing Plus --- MCP Mathematics --- MCP Phonics --- MCP Spelling Workout --- MyWorld Social Studies --- История Notgrass --- Основная математика --- Саксонская грамматика и письмо --- Саксонская математика --- Саксонская акустика --- Science Fusion --- Пой, пишите, читайте и пишите --- Мыслите, как гражданин --- Слова по-своему --- Пишите исходники --- Детский сад --- 1-й класс --- 2-й класс- - 3-й класс --- 4-й класс --- 5-й класс --- 6-й класс --- 7-й класс --- 8-й класс --- 9-й класс --- 10-й класс --- 11-й класс --- 12-й класс- - CollegeDigital DownloadsSoftware --- 1-5 классы --- 6-8 классы --- 9-12 классы Онлайн-курсы

Поиск Записная книжка читателей «

ответов к путешествиям» 4 класс

1 Answers to Journeys Записная книжка для читателей 4-й класс Бесплатная электронная книга в формате PDF Скачать: Электронная книга Answers To Journeys для читателей 4-й класс Скачать или прочитать онлайн-книгу ответы на поездки для читателей тетрадь 4-го класса в формате PDF Из базы данных лучшего руководства HMH Journeys 1-й степени, том 1 [] .. HMH Journeys Grade HMH Journeys Практическая книга 4 класс [] .. Штек Вон. читают ли они на уровне, ниже или выше. Путешествие. Читатели HMH получают уровень грамотности от Ирен Фунтас, и они идеально подходят для первого раза. Фэрфакс, Марсен. 4. Основные инструкции по путешествиям. Еженедельные инструкции по поездкам в малых группах. Урок для учителя. Читатели с трудностями. Инструкция уровня 2. 11 июля, Техас Путешествие - Практическая книга, Том. 1. Harcourt GRADE TX Journeys SE, Уровень 1, Том 1. УРОВЕНЬ 5 .. Электронные книги и документы Bellow предложит вам все ответы на вопросы о путешествиях, читательский блокнот 4 класса! # 3-текстовые ответы в поездках # 3-текстовые ответы в поездках Третий учебный сдвиг встречается во всех 4 направлениях, которые включают чтение (оба вопроса.Каждый урок в Journeys содержит текст привязки и парный текст. Мы не рекомендуем использовать еженедельные тесты, так как эта оценка в основном тестирует. Эта книга в формате PDF содержит информацию о еженедельных тестах для урока 4. Чтобы скачать бесплатно # 3 текстовые ответы в путешествиях, вы

2 KEY Journeys Тестовый пакет B2 Поездки КЛЮЧЕВЫЕ поездки учителя B2 Тестовый пакет B2 Поездки B2 Грамматика учителя. 1 по точке. 2 пока. 3 подойдет. 4 собирается. 5 Будут ли они построены.6 получает пакет материалов для учителя Journeys B2 КЛЮЧ от тестового пакета Journeys B2. Эта книга в формате PDF содержит тестовый пакет по грамматике. Чтобы загрузить бесплатные ключевые поездки b2 test pack Journey b2 учитель, который вы знаете, записная книжка: ответы Crs 1.pdf millermsmath Know It Notebook: ответы на вопросы 1.pdf Учителя миллермсматики, использующие математику Холта, могут делать фотокопии полных страниц в достаточном количестве, чтобы эта записная книжка знала помочь вам делать заметки, организовывать свое мышление и готовиться к тестам. В вашем учебнике есть примеры для каждой изучаемой математической концепции.. Написание Эта книга в формате PDF включает ключевой документ, основанный на геометрии Холта. Чтобы скачать бесплатно блокнот для начинающих: ответы crs 1.pdf millermsmath you Оценка K Путешествие Оценка K Путешествие Харкорт. Путешествие класс K Государственные стандарты английского языка, детский сад. Урок 1. T1. T79 Чтение. Эта книга в формате PDF представляет собой общий базовый документ для детского сада на языке искусств Houghton Mifflin. Чтобы скачать бесплатно класс k Journeys common core you Journeys 2 Grade Spelling List Journeys 2 Grade Spelling List Journeys 2 Grade Spelling List.Урок 1. Урок 2 Урок 3 Урок 4 Урок 5 Урок 6 Урок 7 Урок 8. Кратко a, i. Короткие o, u, e. Длинный а, я. Long o, u. Эта книга в формате PDF содержит информацию о правописании для второго класса. Чтобы скачать бесплатные поездки для 2-го класса, вы можете написать «Путешествие 1-го класса» Путешествие 1-го класса. 1 класс. Уроки. Из. Страница. К. Страница. Государственный стандарт английского языка, 1 класс. Урок 1. T1. T91 Стандарты чтения Эта книга в формате PDF включает руководство по урокам ccss для 4 класса. Чтобы бесплатно загрузить общий базовый уровень путешествий 1-го уровня, вы: Расширенный ответ и короткие ответы Новые читатели нажмите Расширенный ответ и короткие ответы Новые читатели нажмите 3.Расширенный ответ и короткие ответы. Написание для GED. Контрольная работа. Для каждого теста вы будете отвечать на подсказку или тему письма, которую предлагает тест. Эта книга в формате PDF включает руководство по подсказкам для эссе от GED. Чтобы загрузить бесплатные расширенные ответы и короткие ответы новым читателям, нажмите вам нужно: Harcourt / Journeys / Grade 3 Harcourt / Journeys / Grade 3 Harcourt / Journeys / Grade 3. Раздел. Номер индикатора. Комментарии издателя. Свидетельство. Учебный дизайн (ID). 15 / Накопительный обзор. Эта книга в формате PDF включает путеводитель по Houghton Mifflin Harcourt для третьего класса.Чтобы загрузить бесплатно houghton mifflin harcourt / Journeys / grade 3 you

3 Переход для 2-го класса на английский для чтения Путешествие для 2-го класса Переход для 2-го класса на английский для чтения Путешествие с 2-го класса на * Уровень 1 для малых групп 2-го класса. Те учащиеся, у которых начальный уровень 3. Внедрение навыков и. Языковая поддержка. Карты .. Словарь в. Контекстные карты .. Устная речь. Карты .. Декодируемые. Эта книга в формате PDF включает словарный запас о путешествиях в справочник для 3-го класса контекстных карточек.Чтобы загрузить бесплатный переход во 2-й класс к чтению на английском языке, вы Урок № 1 для второго класса: Наши путешествия Урок № 1 для 2-го класса: Наши путешествия Урок № 1 для руководства «Полярная звезда»: Знакомство с нашими собственными путешествиями (для 1–5 классов) . дважды, а затем попросите класс рассказать, что может быть связано с этим сновидением. Эта книга в формате PDF содержит руководство по планам уроков для второго класса. Чтобы загрузить бесплатный урок №1 для второго класса: наши путешествия, северная звезда, вы. Часто употребляемые слова в поездках: 2-й класс, K-5. Часто используемые слова в поездках: 2-й класс. K-5. Часто встречающиеся слова в поездках: 2-й класс.Блок 1. Блок 2. Блок 3. Блок 4. Блок 5. Блок 6 вокруг животных еще один также поперек снова быть медведем далеко позади назад. Эта книга в формате PDF включает информацию о поездках первого уровня. Чтобы бесплатно скачать часто употребляемые слова в путеводителях: 2-й класс k-5, вам необходимо использовать правописание для 3-го класса. Список правописания для учителейWeb. 3-й класс. Орфографический список для 3-го класса. Урок 1. Урок 2 Урок 3 Урок 4 Урок 5 Урок 6 Урок 7 Урок 8. Краткие гласные. V-C-e. Длинный а / е. Длинный о. Эта книга в формате PDF содержит правописание слов третьего класса для путеводителя.Чтобы скачать бесплатные путевки 3-й класс орфографического списка, учитель веб-сайта вы Harcourt / Journeys / Grade 6 Harcourt / Journeys / Grade 6 Harcourt / Journeys / Grade 6. Раздел. Номер индикатора. Комментарии издателя. Свидетельство. Учебный дизайн (ID). 15 / Накопительный обзор. Эта книга в формате PDF включает документ 6-го класса о путешествиях Houghton Mifflin Harcourt. Чтобы скачать бесплатно Houghton Mifflin Harcourt / Journeys / Grade 6 You Harcourt / Journeys / Grade 1 Harcourt / Journeys / Grade 1 Harcourt / Journeys / Grade 1 Harcourt, для детей, которые готовы к этому,См. Модульный проект для класса 1, модуль 6 TE, стр. 3. Эта книга в формате PDF включает документ houghton mifflin, посвященный пониманию уровня 1, модуль 3. Чтобы загрузить бесплатно houghton mifflin harcourt / Journeys / grade 1, вы согласились с поездками. Урок 1 Второй класс. Второй класс, согласованный с поездками. Раздел 1, урок 1. Второй класс. Еженедельные коррелированные планы уроков и ресурсы для 2-го класса: семьи. Моя семья Джорджа Анконы ---. Путешествие pp Диаграмма ВеннаСравните и. Контраст --- Как эта книга в формате PDF предоставляет моей семье документ о деятельности Джорджа Анконы.Чтобы скачать бесплатно выровненный с поездками блок 1 урок 1 второй класс 2-й класс вы

4 Word Journeys Орфография во 2-м классе Школы Keller ISD Word Journeys Орфография во 2-м классе Школы Keller ISD Программа проверки правописания во 2-м классе называется Word Journeys и будет использоваться Blue Group их проверка правописания каждый понедельник (если понедельник - выходной, они будут. Эта книга в формате PDF содержит документ со списком правописания для второго класса. Чтобы бесплатно скачать орфографию для 2-го класса, вы ПУТЕШЕСТВУЙТЕ по орфографии 1-го класса Школа Правописание 1-го класса Город ПУТЕШЕСТВИЙ Слова Школа Город Путешествий 4 класс Правописание слов.Урок 1. Урок 2. Урок 3. Урок 4. Урок 5. Урок 6 лезвие серое прошлое боится магии задержка изумляет, может быть. Эта книга в формате PDF содержит документ с орфографическими словами для первого класса. Чтобы скачать бесплатные путеводители для 1-го класса, написание слов «школьный город», вам необходимо ресурсы класса «Путешествие в 4-й класс» ЧТЕНИЕ ИСТОРИИ Ресурсы для класса «Путешествие в 4-й класс» ЧТЕНИЕ ИСТОРИИ Ресурсы для класса «Путешествие в 4-й класс». ИСТОРИЯ Путешествие. Суффиксы (-ly, -y): урок 2 этап. 44 и 3 этап урок 77 3 этап 23 урок (V-23A / V-23B). Жаворонок.Эта книга в формате PDF включает урок 23-го урока о путешествиях для 2-го класса. Чтобы загрузить бесплатную статью о ресурсах класса для 4-х классов, где вы читаете Harcourt / Journeys / Grade 2 Indiana Harcourt / Journeys / Grade 2 Indiana 26. Красные прямоугольники монитора в инструкциях для всей группы предоставляют руководство по формированию гибких небольших групп. См. Небольшой. Группа. Эта книга в формате PDF содержит документ Houghton Mifflin для первого урока 26 класса. Чтобы загрузить бесплатно Houghton Mifflin Harcourt / Journeys / Grade 2, Indiana You Grade 3 Scope and Sequence Matrix Texas Journeys 1 Grade 3 Scope and Sequence Matrix Texas Journeys 1 Grade 3 Scope and Sequence Matrix.Техасские путешествия. 1. БЛОК 1: Урок. Выборы. Акустика. Беглость. Понимание. LVS. Запас слов. Орфография. Грамматика. Эта книга в формате PDF содержит руководство по орфографии для 3-го класса. Чтобы скачать бесплатно матрицу объема и последовательности для 3-го уровня, texas Journeys 1 you 4-й класс Матрица объема и последовательности Texas Journeys 4-й класс Матрица объема и последовательности Texas Journeys Правописание слов. Основные слова: лезвие, объем 4 класса и матрица последовательности. Техасские путешествия. 2. Урок. Выборы. Расшифровка. Правописание слов. Основные слова :. Эта книга в формате PDF содержит информацию о уроке 4 со списком орфографии для 4-го класса.Чтобы бесплатно загрузить объем 4 класса и матрицу последовательности, texas Journeys you Notebook 1 Рабочие ответы Записная книжка школ округа Чероки 1 Рабочие ответы Школы округа Чероки NB 1: БАЗОВЫЕ КОНЦЕПЦИИ НОУТБУК ОТВЕТОВ Блок-схема потока товаров / услуг в качестве примера, обозначьте эти транзакции .. возможность Стоимость пребывания дома в субботу вечером часто бывает выше, чем в понедельник вечером, когда вы это делаете. Эта книга в формате PDF включает блок-схему ответа на ночной документ. Чтобы загрузить бесплатную тетрадь 1 работа ответы школы округа чероки

5 Предварительная лаборатория по гальваническим элементам: ответы в лабораторной тетради в начале предварительной лаборатории по гальваническим элементам: ответы в лабораторной записной книжке в начале В этой лабораторной работе вы создадите гальванические / гальванические элементы, которые генерируют электричество от них доступно ниже (как твердые металлы, так и водные растворы), как указано в фактических концентрациях для расчета Q, E оказывается небольшим и положительным (спонтанно Эта книга в формате PDF включает в себя небольшой документ с ответами лаборатории гальванических элементов.Чтобы скачать бесплатно предварительную лабораторию по гальваническим элементам: ответы в лабораторной тетради в начале вам необходимо получить 1 класс 1 класс 1 класс. Поездки. 1 класс. Стандарты изучения английского языка. Урок 1. Нормы чтения литературы K5. Диапазон чтения и уровень. Эта книга в формате PDF содержит урок, посвященный 4-му классу, ccss. Чтобы скачать бесплатно Houghton Mifflin Harcourt Journeys Grade 1 Common Core you / Grade 6 / Grade 6 / Grade 6. Section. Руководство по показателям предписывает уроки повторного обучения Уровня I для небольших групп учащихся.Эта книга в формате PDF включает в себя информацию о планах уроков для 6-го класса. Чтобы скачать бесплатно houghton mifflin harcourt / Journeys common core / grade 6 you / Grade 3 / Grade 3 лексическое слово, используя богатые задания Talk It Over из словаря в контекстных карточках. п. T47: В день 3 учащиеся отвечают на обстоятельные вопросы, которые поощряют. Эта книга в формате PDF включает словарный запас о путешествиях в контекстные карточки поведения для 3 класса. Чтобы скачать бесплатно Houghton Mifflin Harcourt / Journeys common core / grade 3 you Grade 4 Grade 4 Grade 4.Путешествие. 4 класс. Стандарты изучения английского языка. Урок 1. Нормы чтения литературы K5. Ключевые идеи и детали. Эта книга в формате PDF включает в себя документ ccss урока 4 класса путешествий. Чтобы скачать бесплатно Houghton Mifflin Harcourt Journeys для 4-го уровня, вам необходимо / Grade 2 / Grade 2 Journeys. См. Следующие страницы в Блоке 1. TE. стр. T10T11: Беглость появляется каждый день на. Предлагаемый еженедельный планировщик. п. Эта книга в формате PDF содержит общий основной документ для входа в систему. Чтобы скачать бесплатно houghton mifflin harcourt / Journeys common core / grade 2 you State Standards Journeys 2011 Grade 1 State Standards Journeys 2011 Grade 1 Correlation to the.. Государственные стандарты. Путешествие 1 класс. Издательство Harcourt Publishing Company. Все права защищены. Напечатано в этой книге в формате PDF, которая содержит первоклассную корреляцию информации ccss по алгоритму Houghton Mifflin. Чтобы скачать бесплатно общие основные государственные стандарты 2011 года, вы можете

6 государственных стандартов, 2011 год, четвертый класс, государственные стандарты, 2011 год, четвертый класс, 4-й класс Harcourt Publishing Company. персонажи из мифологии (например, геркулесовы). Том 1 :. закономерности событий (например,g., квест) в рассказах, мифах и используйте общие, соответствующие классу греческие и латинские аффиксы. Эта книга в формате PDF включает документ о путешествиях по греческой мифологии. Чтобы бесплатно загрузить общие основные стандарты штата 2011 класс 4, вам необходимо / 5-й / 5-й класс интерпретировать оценки учащихся по каждому направлению навыков Еженедельника. Контрольная работа. Руководящие принципы предписывают уроки повторного обучения Уровня I для небольших групп учащихся, набравших меньше баллов. Эта книга в формате PDF содержит информацию о еженедельных тестах для урока 4. Чтобы скачать бесплатно Houghton Mifflin Harcourt / Journeys common core / grade 5 you / Grade 4 / Grade 4 / Grade 4.Раздел. Номер индикатора. Комментарии издателя. Свидетельство. Учебный дизайн. 5. Подробное описание Дополнительные курсы, соответствующие учебной программе, см. На странице. Лидерство. Эта книга в формате PDF содержит общие рекомендации по выравниванию сердцевины 5 степени Houghton Mifflin. Чтобы скачать бесплатно Houghton Mifflin Harcourt / Journeys common core / Grade 4 You Grade 6 Grade 6 1. Harcourt. Путешествие. 6 класс соотносился с. Государственные стандарты. Искусство английского языка. 6 класс. Путешествие. 6 класс. Эта книга в формате PDF включает в себя рассказы о поведении 6-го класса о путешествиях по хоутон-миффлин-харкорт.Чтобы скачать бесплатно Houghton Mifflin Harcourt Journeys Grade 6 Common Core You Grade 3 Grade 3 1. Harcourt. Путешествие. 3-я оценка соотносилась с. Государственные стандарты. Искусство английского языка. 3 класс. Путешествие. 3 класс. Эта книга в формате PDF предоставляет информацию о путешествии третьего класса Houghton Mifflin Harcourt. Чтобы скачать бесплатно Houghton Mifflin Harcourt Journeys grade 3 common core you Grade 2 Grade 2 1. Harcourt. Путешествие. Оценка 2 соотносилась с. RF.2.3f Распознавать и читать слова с неправильным написанием, соответствующие классу.Эта книга в формате PDF содержит орфографический документ для 2-го класса путешествий Houghton Mifflin. Чтобы скачать бесплатно Houghton Mifflin Harcourt Journeys grade 2 common core you Grade 5 Grade 5 1. Harcourt. Путешествие. 5-й класс соотносился с. Государственные стандарты. Искусство английского языка. 5 класс. Путешествие. 5 класс. Эта книга в формате PDF содержит общую основную информацию компании Houghton Mifflin. Чтобы скачать бесплатно Houghton Mifflin Harcourt Journeys 5 класс common core you

7

8 State Standards Journeys 2011 Grade 3 State Standards Journeys 2011 Grade 3.Издательство "Харкорт". Государственные стандарты обучения английскому языку, 3 класс. Авторские права Эта книга в формате PDF содержит путеводитель по Houghton Mifflin Harcourt для третьего класса. Чтобы бесплатно загрузить общие основные государственные стандарты Journeys 2011 Grade 3 you Grade 3 Scope and Sequence Matrix Texas Journeys 1 UNIT 1 Grade 3 Scope and Sequence Matrix Texas Journeys 1 UNIT 1 Grade 3 Scope and Sequence Matrix. Техасские путешествия. 1. БЛОК 1: Слова. Принцип правописания. Краткие гласные. Правописание слов. Основные: урожай, план, вещь, запах, закрытие.Эта книга в формате PDF содержит орфографические слова для третьего класса для путеводителей. Чтобы скачать бесплатно 3-й уровень и матрицу последовательности техасских путешествий 1 единица 1, вы, Koosh Ball Game, совокупный обзор 2 (ответы) .notebook, Koosh Ball Game, совокупный обзор, 2 (ответы) .notebook, Koosh Ball Game, совокупный обзор, 2 (ответы) .notebook. 1. 14 февраля, 87:52 AM Какие из следующих химических свойств? Которые. Эта книга в формате PDF включает в себя ответы на совокупный обзор химии. Чтобы скачать бесплатно koosh ball game cumulative 2 review (ответы).notebook you Для читателей с 4-го по 6-й классы Scumble HPE Library Для читателей с 4-го по 6-й класс Scumble HPE Library Shoot-Out Автор: Майк Лупика. Сайт Майка Лупики. Что происходит, когда звездный игрок проверяет свое спортивное мастерство каждый раз, когда его футбольная команда покрывается воском. Но это. Эта книга в формате PDF содержит тестовый документ «Перестрелка по люпике». Чтобы бесплатно скачать библиотеку scumble hpe для читателей с 4 по 6 классы, вам необходимо: БЛОК УЧАСТИЯ 3 УРОВЕНЬ 2 Соответствует блоку 3 Поездки БЛОК УЧЕБА 3 УРОВЕНЬ 2 Соответствует закрытию писем блока 3 Путешествие.Я могу использовать словарь, чтобы найти правильное написание слова ... многозначные слова и фразы на основе чтения и содержания 2-го класса. Эта книга в формате PDF включает в себя список правописания второго класса путешествий. Чтобы загрузить бесплатную единицу изучения 3-й класс, 2-й класс соответствует разделу 3 «Путешествие по твоему взгляду». Слова для читателей. Успешные читатели используют несколько слов для чтения. Успешные читатели. Когда ребенок может схватывать и распознавать слова на экране, тогда представьте, что вы не знаете слова «the».Вы не можете использовать. Эта книга в формате PDF включает в себя руководство по списку слов для детского сада. Чтобы скачать бесплатные слова для читателей, успешные читатели используют несколько из вас mybooklibrary.com

IGNOU - The People's University

Программа:

Выбор программы - Выбор - ACEACFSACISEACPDMACSEPDACSMADACMADAOMADCMADITADTSAIPRAPDFAPSMBIOAPSMGAPSMWAPSSAPVPFVASSOASSOCIATEATPDBABAADMBAASLSBAAVFXBACTBAFCBAFDBAFMPBAIHABARCHBBARLBBARSBBARSDLBCABCOMBCOMAFBCOMCAABCOMFCABCSSIBEDBEDSEBEDSEHIBEDSEMRBEDSEVIBHMBIHMBITBLISBMITBMLTBMRHITBNSBPPBPPDSBPPDS BRTTBSCBSCFMRMBSCFWTBSCHIHABSCHOTBSCLGADBSCNBSWBTAEBTCLEVIBTCMBTCSVIBTECVIBTELVIBTMEBTMEVIBTSBTWRECAFECAHCCAHTCAISCALCAPCARHCAYCBEDCBSCCDPCCEANMCCITSKCCLBLCCLCCCMHCCPCCPDCCRCCSSCDCWCDMCDNKCDNMACDOCDTPCELLCEMBACEMPACESCESECPCESEHICESEMRCESEVICETECETMCFECFLCFNCFSCFSTYCGLCGMSMCHAACHBCPCHBHCCHCWMCHETCHRCIAPCIATCIBCICCICTALCIECIFCIGCIHLCISCITCITSMCJDCJLCLDCLGMCLLCLPCMCHCCMCHNCMSRCNCCCNICCNINCNMCNOCCOFCPACPABNCPAHMCPAKMCPAKPCPAKTCPAMCPAMPCPAOSCPATCPATHACPECPELCPFCPFMCPHNCPISASCPLTCPPDPTCPPLCPSCPSKCPSLCPVECRDCRFCRFFCRHCRHTCRMCRSCRULCSEPDCSICSLFCSMCSSACSUCCSUSCSWCJSCTAOCTECTGSCTPMCTSCTVMCULCVACVAACVAPCVASCWDLCWDMCWEDCWHMCYPDAFEDAQDBPOFADCCNDCEDCHDCIMDCLCDCLEDCLEGDCLEVIDCODCSVIDCYPDDEDDTDECEDECVIDELEDDEL VIDEMEDESDDFPTDFSDFSTYMDHNEDHOTRMDIMDIPPDMEDMEVIDMLTDMTDNADNHEDNSDPEDPLADDPVCPODRITDSMDTGDTSDULDVAPFVDWEDDWMEMBAHMEMBAIHMEMBAITEXMBAFCEDIPHDPALPHECOLPNSSDMAAEMAANMAAPMMADEMADE2MAEDSMAEDUMAEMPMMAFRMMAGDMAHMAJMCMAPCMAPDMAPYMARDMASAMASASMATSMAWGSMAWGSCLMBAAVBMMBABFEVMBABMMBACGMBACNMBACTMBAEVMBAFMMBAFTMBAHMMBAIHMMBAITMMBAMAFCIMBANIMMBARSMBASCMFLMBATEXMMCAMCOMMCOMBPCGMCOMFTMCOMIDTMCOMMAFSMECMEDMEDSEHIMEDSELDMEDSEMRMEDSEVIMEGMFAPMGPSMHAMHDMIPLMLDMLISMPMPAMPAHVMMPATHAMPBMPHILMPHILCOMMPHILDEMPHILECMPHILPSMPHILRSOMPHILSOMPHILSOCMPHILSWMPHILTHMPHILTTMPPMPSMSBOBIMSBOCCMSBOMMMSBOTMSCAECMSCASMSCBIBOMSCCFTMSCCHEMMSCCRDMSCDFSMMSCFMRMMSCFWTMSCLGADMSCLSCMSCMACSMSCVMCDMSNNMSOMSSTMSWMSWCMSWNEMSWPMTECHAEMTECHCSMTECHESDMTECHISSMTECHNBMTECHNEMTECHSDMTECHSRMTECHSTMTECHTCMTECHTSMTECHVDMTMNCDCPNIPDFNIPFPPNIPOANIPWMPCSEPDPDCDMPGCAEPGCAPPGCBGSAPGCBHTPGCCLPGCCL_OLPGCCPPGCEPGCEDSPGCENCPGCEPDPGCGIPGCGPSPGCHIPGCIATIVIPGCIERAPGCIVPGCMHTPGCMIPGCMLPGCMRRPGCOIPGCPPGCPDNPGCPDTPGCPMPGCPPPGCPPKPGCQMPGCRWPGCSOPGCSRVSPGCTWPG CULSAPGDACPGDACPPGDAEPGDAPPPGDASTPGDBEPGDBPPGDCCPGDCFTPGDCJPGDDEPGDDHMPGDDMPGDEDSPGDELPGDEMAPGDENLWPGDENLWOLPGDESDPGDETPGDFCSPGDFIMKTPGDFMPPGDFSQMPGDFSTYDPGDFSTYDMPGDFTPGDGBLPGDGBLFFPGDGBLPPGDGBLPTPGDGMPGDGPSPGDHAMPGDHEPGDHEMPGDHHMPGDHIVMPGDIBOPGDICGPGDIEPGDIPRPGDISPGDLANPGDLPOPGDMCHPGDMDPGDMISHEPGDMRRPGDPDPGDPDNPGDPMPGDPPEDPGDPSMPGDRBIPGDRDPGDREPYPGDREPYDLPGDRPPGDSICPGDSLMPGDSOPGDSSPGDSWPGDSWTPGDTPGDTACPGDTCDPGDTRMPGDUGPGDUPDLPGDVSSAPGDWGSPGJMCPGPCSEHIPGPCSEMRPGPCSEVIPGPDSEHIPGPDSEMRPGPDSEVIPHDPHDAEPHDAGEPHDALPHDANPHDBCPHDCDEVPHDCEEPHDCEMPHDCENGPHDCHEPHDCISCPHDCMCEPHDCOPHDCOMPHDDEPHDDRPHDDSPHDECPHDEDSPHDEDUPHDENGPHDFAPHDFLPHDFNPHDGDSPHDGGPHDGTSPHDGYPHDHINPHDHISPHDITSPHDJMCPHDLAWPHDLISPHDLSPHDMCEPHDMDPHDMGMTPHDMTPHDMTEDPHDMUPHDNURPHDPAPHDPCPHDPHPHDPSPHDPVAPHDRDPHDRSOPHDSOCPHDSTATPHDSWPHDTHPHDTSPHDTTPHDVEDPHDVETPHDWSSAVINI

Codeforces

С Новым годом, Codeforces!

UPD: Мы получили настолько разные мнения о порядке проблем, что мы не можем быть полностью уверены в этом.Рекомендуем ознакомиться со всеми задачами и не сильно надеемся, что сложность для вас обязательно совпадет с порядком в раунде.

Здравствуйте! Codeforces Round # 693 (Div.3) начнется 04.01.2021 в 17:35 (мск). Вам будет предложено 7 задач с ожидаемой сложностью, чтобы составить интересное соревнование для участников с рейтингом до 1600. Однако все желающие принять участие и иметь рейтинг 1600 или выше могут зарегистрироваться в раунде неофициально.Раунд будет проводиться по правилам образовательных туров (расширенный ICPC). Таким образом, в ходе раунда решения будут оцениваться на предварительных тестах, а после раунда будет 12-часовая фаза открытых взломов. Мы постарались провести сильные тесты - точно так же, как вы расстроитесь, если многие решения не сработают по окончании конкурса.

Вам дается 7 задач и 2 часа на их решение.

Обратите внимание, что штраф за неправильную подачу в этом раунде (и следующих раундах Див. 3) составляет 10 минут .

Помните, что в официальную таблицу будут включены только проверенные участники третьего дивизиона. Как написано по ссылке, это принудительная мера по борьбе с неспортивным поведением. Чтобы квалифицироваться как доверенные участники третьего дивизиона, необходимо:

  • принять участие как минимум в двух рейтинговых раундах (и решить хотя бы одну задачу в каждом из них),
  • не иметь балла 1900 или выше в рейтинг.

Независимо от того, являетесь ли вы доверенным участником третьего дивизиона или нет, если ваш рейтинг меньше 1600, то раунд будет оценен за вас.

Задачи для этого раунда были придуманы Майком Мирзаяновым и подготовлены Supermagzzz и Stepavly

Спасибо Майку Мирзаянову за платформы и координацию нашей работы. Благодарим darkkcyan, Aris_244_, Mukundan314, PrideBlack, Nemo, pashka, Rox за помощь в подготовке и тестировании раунда.

Удачи!

UPD: От редакции

.

Добавить комментарий

©2021 «Детская школа искусств» Мошенского муниципального района